PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa11g016750.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family NAC
Protein Properties Length: 302aa    MW: 33367.2 Da    PI: 8.9533
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa11g016750.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.81.8e-52141391128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrF Ptdeel+v+yL++kv+g +++l +vi ++d+yk++PwdLp+k+  +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk ++s 
  Csa11g016750.1  14 LPPGFRFYPTDEELLVQYLCRKVAGYHFSL-QVIGDIDLYKFDPWDLPSKALFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKIITS- 106
                     79***************************9.99***************8777899***********************************9999. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                     +g+ vg+kk Lvfy g+apkg+kt+W+mheyrl
  Csa11g016750.1 107 DGRRVGIKKALVFYAGKAPKGTKTNWIMHEYRL 139
                     999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-679162IPR003441NAC domain
PROSITE profilePS5100561.18714162IPR003441NAC domain
PfamPF023656.4E-2615139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MGVREKDPLA QLSLPPGFRF YPTDEELLVQ YLCRKVAGYH FSLQVIGDID LYKFDPWDLP  60
SKALFGEKEW YFFSPRDRKY PNGSRPNRVA GSGYWKATGT DKIITSDGRR VGIKKALVFY  120
AGKAPKGTKT NWIMHEYRLI EHSRSHGSSK LDDWVLCRIY KKTSGSQRQA ASAATPVQAC  180
REEHSTNGSS SSSSSQLDDV LDSFPEIKDQ SFNLPRMNSL RTILNGNFDW ASLAGLNPIP  240
ELAPTNGLPS YGGYDSFRAA EGEAESGLRN SHVDNSGGLT QSFGYSSSGF GVSGQTFGFR  300
Q*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D1e-10811687174NAC domain-containing protein 19
3swp_C1e-10811687174NAC domain-containing protein 19
3swp_B1e-10811687174NAC domain-containing protein 19
3swp_A1e-10811687174NAC domain-containing protein 19
3swm_D1e-10811687174NAC domain-containing protein 19
3swm_C1e-10811687174NAC domain-containing protein 19
3swm_B1e-10811687174NAC domain-containing protein 19
3swm_A1e-10811687174NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0837380.0AF083738.1 Arabidopsis thaliana clone sps433 unknown mRNA.
GenBankAY0877720.0AY087772.1 Arabidopsis thaliana clone 38344 mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010438620.10.0PREDICTED: NAC domain-containing protein 72-like
SwissprotQ93VY30.0NAC72_ARATH; NAC domain-containing protein 72
TrEMBLA0A0A1EIC10.0A0A0A1EIC1_OLIPU; NAC026
STRINGAT4G27410.30.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14352795
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.20.0NAC family protein